Scaffold JGI12666J13322_100017

Overview

Basic Information

• Taxon OID: 3300001111
• Scaffold ID: JGI12666J13322_100017
• Source Dataset Name: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2666
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Davy Crockett National Forest, Groveton, Texas, USA
• Coordinates
  • Lat. (^o): 31.11
  • Long. (^o): -95.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037452	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12666J13322_1000174	F037452	N/A	MESSFLIEVDNTSILRTGALHCYHYTLNRLPAPRLLLPRSGLERSDFVLWPNPG