| Basic Information | |
|---|---|
| Taxon OID | 3300001109 Open in IMG/M |
| Scaffold ID | SMH020_1010733 Open in IMG/M |
| Source Dataset Name | 04YSMH020 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 871 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Seven Mile Hole Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.75491405 | Long. (o) | -110.41586031 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011451 | Metagenome / Metatranscriptome | 291 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SMH020_10107331 | F011451 | N/A | TMPIEIISVTFANNSTAKEWAVVSDLGGKAEVNQFCSSYGGPFCIYPWYTLGSSGFHYGVDYGDTIKDFGKANQFAQEPLCGGPFGPNTTYCDTIIIK* |
| ⦗Top⦘ |