Scaffold SMH020_1003569

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SMH020_1003569

Scaffold SMH020_1003569

Overview

Basic Information
Taxon OID	3300001109 Open in IMG/M
Scaffold ID	SMH020_1003569 Open in IMG/M
Source Dataset Name	04YSMH020
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2249
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park

Source Dataset Sampling Location
Location Name	Seven Mile Hole Yellowstone National Park
Coordinates	Lat. (^o)	44.75491405	Long. (^o)	-110.41586031	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100775	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
SMH020_10035692	F100775	GGAGG	MGRNFTVQELADFLFDRLIVDGPSCPDTEWLRQACQDAAADLLEEAEVVYKQEPVLDGGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.