Scaffold SMH020_1001510

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SMH020_1001510

Scaffold SMH020_1001510

Overview

Basic Information
Taxon OID	3300001109 Open in IMG/M
Scaffold ID	SMH020_1001510 Open in IMG/M
Source Dataset Name	04YSMH020
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4335
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (63.64%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 1 → Candidatus Marsarchaeota G1 archaeon BE_D	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park

Source Dataset Sampling Location
Location Name	Seven Mile Hole Yellowstone National Park
Coordinates	Lat. (^o)	44.75491405	Long. (^o)	-110.41586031	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095752	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
SMH020_10015109	F095752	AGAAG	MVSVPALLELDPYLRILLETAHQDGWDARPLYESLILDEIDYFTFRRVFLEYLSQGFQEIALSVFAKIEEVMLRYAGASIPQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.