| Basic Information | |
|---|---|
| Taxon OID | 3300001096 Open in IMG/M |
| Scaffold ID | JGI11944J13513_1080027 Open in IMG/M |
| Source Dataset Name | Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 560 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | National University of Singapore, Singapore | |||||||
| Coordinates | Lat. (o) | 1.29973 | Long. (o) | 103.771791 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103516 | Metagenome / Metatranscriptome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI11944J13513_10800271 | F103516 | N/A | TPELQKSRCYNFLSAGREGEMIAKKSNVLLNECNLTAKDAVDRVTYLTYTTRDAYVAESGENQVISKRVMGNKDIEIESRLFYEKEGGVRGIQVLINDFVDKNYVKGYEPEWVVRALYREVKMQDGKIVVVRDGMTRDEFMKEDEIEHYKKLNRMLK* |
| ⦗Top⦘ |