Scaffold JGI12104J13512_1041196

Overview

Basic Information

• Taxon OID: 3300001095
• Scaffold ID: JGI12104J13512_1041196
• Source Dataset Name: Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Biofilm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 743
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location

• Location Name: National University of Singapore, Singapore
• Coordinates
  • Lat. (^o): 1.29973
  • Long. (^o): 103.771791

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049732	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12104J13512_10411962	F049732	N/A	MDVLRILFNILLFTASLFAAALAVEKIYAGRWKWAAFAVLMGFILGFALVPGALIGVLEALPGGFSAANAAVLVLGGVA