NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12037J13215_1002922

Scaffold JGI12037J13215_1002922


Overview

Basic Information
Taxon OID3300001063 Open in IMG/M
Scaffold IDJGI12037J13215_1002922 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0556
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1202
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-26.91Long. (o)-21.43Alt. (m)Depth (m)3199.21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071317Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
JGI12037J13215_10029223F071317N/AMLKKITAVGLITLFAGVTAAPLIHLDECNMPCCAGLATSCCDMDQEVACPTISDCGSSIFVLIVLGPFHKSELKSSDSISQRFVTDLDIFKIETNYVTSFGNYDPGPMASLNLPLLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.