NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001063

3300001063: Marine microbial communities from the Deep Atlantic Ocean - MP0556



Overview

Basic Information
IMG/M Taxon OID3300001063 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054820 | Ga0000804
Sample NameMarine microbial communities from the Deep Atlantic Ocean - MP0556
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31900329
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth Atlantic Ocean
CoordinatesLat. (o)-26.91Long. (o)-21.43Alt. (m)N/ADepth (m)3199.21
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057445Metagenome / Metatranscriptome136N
F071317Metagenome / Metatranscriptome122N
F071320Metagenome / Metatranscriptome122N
F089571Metagenome109N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12037J13215_1000514All Organisms → cellular organisms → Bacteria5345Open in IMG/M
JGI12037J13215_1000909Not Available3216Open in IMG/M
JGI12037J13215_1002835Not Available1231Open in IMG/M
JGI12037J13215_1002922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae → Shewanella1202Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12037J13215_1000514JGI12037J13215_10005143F089571MFIIYLDKENERKMLKNIIVIVFSVLFLVVPASSQHVQQKYAITDKDEKVILNDNGTWEYAEEDKQNYYYKKVPPKTYNYEFKSQTWEERIEQAAHEYWRIRAHAELEQLGIPVTRYDPTTSDVPLYLKLEGGRIRTDLDSFTPLARGEVIDISGLWDPDKGDNPTLKIQGKLFLQITMKLDDQKKLFSQYNQRNYIPIPDDFQRILEFRDSLDVISLGMHDYNRDNTHIWPGIPHSFLYAPPGSYYDPNNPPIIHGDGFPYIQRGHLTLSRREIPMTNSVYDNLLKRIDNLEGHGPIKIRYDMGKGIIETVTFEEVWLKINPYNGDPTHILKKVSLNKLE*
JGI12037J13215_1000909JGI12037J13215_10009094F071320VISWEATVSQGWEKIARDDKLYSMASRVPVFDADIPLRESVFFLSNPSRCFRNNPDRLYCSSDCR
JGI12037J13215_1002835JGI12037J13215_10028351F057445LQKLSKAAVNEILPKAVSLILIKERLENKRKKDFLDLSDLFSVAPDV
JGI12037J13215_1002922JGI12037J13215_10029223F071317MLKKITAVGLITLFAGVTAAPLIHLDECNMPCCAGLATSCCDMDQEVACPTISDCGSSIFVLIVLGPFHKSELKSSDSISQRFVTDLDIFKIETNYVTSFGNYDPGPMASLNLPLLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.