NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11754J13217_1000198

Scaffold JGI11754J13217_1000198


Overview

Basic Information
Taxon OID3300001060 Open in IMG/M
Scaffold IDJGI11754J13217_1000198 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0103
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8579
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)21.51Long. (o)-23.45Alt. (m)Depth (m)4005.12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089571Metagenome109N

Sequences

Protein IDFamilyRBSSequence
JGI11754J13217_10001983F089571GAGMLKNIIVIVFSVLFLVVPASSQHVQQKYAITDKDEKVILNDNGTWEYAEEDKQNYYYKKVPPKTYNYEFKSQTWEERIEQAAHEYWRIRAHAELEQLGIPVTRYDPTTSDVPLYLKLEGGRIRTDFDSFTPLAXGEVIDISGLWDPDKGDNPTLKXQGKLFLQITMKLDDQKKLFSQYNQRNYIPIPDDFQRILEFRDSLDVISLGMHDYNRDNTHIWPGIPHSFLYAPPGSYYDPNNPPIIHGDGFPYIQRGHLTLSRREIPMTNSVYDNLLKRIDNLEGHGSIKIRYDMGKGIIETVTFEEVWLKINPYNGDPTHILKKVSLNKLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.