Scaffold JGI12195J13216_1002928

Overview

Basic Information

• Taxon OID: 3300001046
• Scaffold ID: JGI12195J13216_1002928
• Source Dataset Name: Marine microbial communities from the Deep Indian Ocean - MP1202
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1926
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Indian Ocean
• Coordinates
  • Lat. (^o): -30.33
  • Long. (^o): 103.31
  • Depth (m): 4000.85

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012125	Metagenome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12195J13216_10029283	F012125	N/A	MSDTRYSVMHPDGGKDSFFSAGKPKNLPRFYFLVLAGIFLXIFMFXWFD*