Scaffold JGI11983J13109_101341

Overview

Basic Information

• Taxon OID: 3300001010
• Scaffold ID: JGI11983J13109_101341
• Source Dataset Name: Marine microbial communities from South of Eden, South Pacific Ocean - MP1434
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 593
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South of Eden, South Pacific Ocean
• Coordinates
  • Lat. (^o): -38.64
  • Long. (^o): 150.41
  • Depth (m): 4001.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010197	Metagenome	307	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11983J13109_1013411	F010197	N/A	LLFDGLNLFLLPNTTHKLKAFTIKHDFAQHMQKVFSRQDGILFSFEEV*