Scaffold JGI12031J13088_100156

Overview

Basic Information

• Taxon OID: 3300000974
• Scaffold ID: JGI12031J13088_100156
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP1092
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4183
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Indian Ocean
• Coordinates
  • Lat. (^o): -29.81
  • Long. (^o): 82.62
  • Depth (m): 4000.29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069480	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
JGI12031J13088_1001561	F069480	N/A	MPNHIEFIDRIYILELCKDVKRVEGNAGQILDEAPKNKPYNTMKTDFFSVFKLEFFSENIQVF