Basic Information | |
---|---|
Taxon OID | 3300000947 Open in IMG/M |
Scaffold ID | BBAY92_10125638 Open in IMG/M |
Source Dataset Name | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 678 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Botany Bay, Sydney, NSW, Australia | |||||||
Coordinates | Lat. (o) | -33.966629 | Long. (o) | 151.166614 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087232 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BBAY92_101256383 | F087232 | N/A | ELFLENKGQITPEMSVIGDEIKIVIRSIIRQQEEQVQSNPKDGEIHLYAG* |
⦗Top⦘ |