 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087232 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | EMSVLGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 20.37 % |
| % of genes near scaffold ends (potentially truncated) | 79.09 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.818 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (42.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (70.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.82 % |
| All Organisms | root | All Organisms | 28.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 42.73% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.18% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.18% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.36% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.64% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.73% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 2.73% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 2.73% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.82% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.82% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.82% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.91% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.91% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.91% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.91% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.91% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084006 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_dispersant_7 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007537 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016703 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021465 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MG | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2224066357 | 2222084006 | Marine | MSVLGDEIKNVIRSIIGQQEEQVRTNPRDGEIHLYAG |
| BBAY92_101256383 | 3300000947 | Macroalgal Surface | ELFLENKGQITPEMSVIGDEIKIVIRSIIRQQEEQVQSNPKDGEIHLYAG* |
| BBAY94_101407623 | 3300000949 | Macroalgal Surface | GQITPEMSVIGDEIKIVIRSIIRQQEEQVQSNPKDGEIHLYAG* |
| JGI11772J19994_10208281 | 3300001748 | Saline Water And Sediment | GQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0055442_103671732 | 3300004029 | Natural And Restored Wetlands | QITAEMSVIGDEIKTVIRSIIRQQEEQVQTNPRDGEIHLYAG* |
| Ga0074648_10963763 | 3300005512 | Saline Water And Sediment | ITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPKDGEIHLYAG* |
| Ga0074648_12241681 | 3300005512 | Saline Water And Sediment | AEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEVHLYAG* |
| Ga0074647_10024128 | 3300005611 | Saline Water And Sediment | TAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEVHLYAG* |
| Ga0074647_10056516 | 3300005611 | Saline Water And Sediment | TAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG* |
| Ga0074647_10056727 | 3300005611 | Saline Water And Sediment | TAEMSVIGDEIKTVIRSIIRQQEEQVRTNPKDGEIHLYAG* |
| Ga0074649_10257827 | 3300005613 | Saline Water And Sediment | PEMSVLGDEIKNVIRSIIRQQEEQVRTNPRDGEIHLYAG* |
| Ga0074649_11342951 | 3300005613 | Saline Water And Sediment | ITAEMSVIGDEIKTVIRSIIRQQEEQVQTNPLDGEIHLYAG* |
| Ga0075462_100920163 | 3300006027 | Aqueous | AIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0075503_10502991 | 3300006400 | Aqueous | MSVLGDEIKQTIRSILRAQEAKVHTNPLDGEVHLYAG* |
| Ga0075514_11084853 | 3300006403 | Aqueous | MSVLGDEIKNVIRSIIRQQEEQVHSNPRDGEIHLYAG* |
| Ga0075461_101479361 | 3300006637 | Aqueous | PEMSVIGDEIKIVIRSIIKKQEEQVHSNPKDGEIHLYAG* |
| Ga0075461_102234132 | 3300006637 | Aqueous | IGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0075467_103232323 | 3300006803 | Aqueous | EMSVIGDEIKTVIRSIIRQQEEQVHSNPRDGEIHLYAG* |
| Ga0070754_104391262 | 3300006810 | Aqueous | VIGDEIKTVIRSIIRQQEEQVQTNPRDGEIHLYAG* |
| Ga0075110_10536121 | 3300007074 | Saline Lake | EMSVLGDEIKRVVRSIIREQEEEVLSNLKNGEVHLFAG* |
| Ga0075460_100976111 | 3300007234 | Aqueous | ITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEVHLYAG* |
| Ga0075460_101060233 | 3300007234 | Aqueous | MSVLGDEIKQVIRSIIRKQEEEVHINPLDGEIHLYAG* |
| Ga0075460_101602131 | 3300007234 | Aqueous | MSVLGDEIKRVVRSIIREQEAEVLNNLKDGEIHLYAG* |
| Ga0075460_102185342 | 3300007234 | Aqueous | MSVIGDEIKIVIRSIIKKQEEQVHSNPKDGEIHLYAG* |
| Ga0075463_100082057 | 3300007236 | Aqueous | MSVLGDQIKTVIRSILKNQESPKRNPLDGEIHLFAG* |
| Ga0075463_100183764 | 3300007236 | Aqueous | MSVLGDEIKTVIRSIIKKQEAEIHTNPRDGEIHLYAG* |
| Ga0075463_100618112 | 3300007236 | Aqueous | LFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0075463_101734192 | 3300007236 | Aqueous | MSVLGDEIKQVIRSIIRKQEAEVHTNPLDGEVHLYAG* |
| Ga0070753_13703622 | 3300007346 | Aqueous | LFLENKGQITAEMSVIGDEIKIVIRSIIRQQEEQVQTNPLDGEIHLYAG* |
| Ga0102934_13673191 | 3300007537 | Pond Soil | TAEMSVLGDEIKQVIRSIIRKQEAEVHTNEKDYEVHLYAG* |
| Ga0099851_12798001 | 3300007538 | Aqueous | MSVLGDEIKNVIRSIIRQQEEQVRTNPRDGEIHLYAG |
| Ga0099847_10896251 | 3300007540 | Aqueous | FLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0099846_11290011 | 3300007542 | Aqueous | IGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG* |
| Ga0102957_11806933 | 3300009027 | Pond Water | MSALGDEIKTVIRSIIKKQETEVHTNPRDGEIHLYAG* |
| Ga0102957_12876781 | 3300009027 | Pond Water | PEMSVLGDEIKRVIRSIIREQEAQVHNNPRDGEVHLFAG* |
| Ga0102956_13668261 | 3300009033 | Soil | SVLGDEIKQTIRSILRAQEAEVHTNPKDGEIHLYAG* |
| Ga0115566_102124973 | 3300009071 | Pelagic Marine | MSVLGDEIKRVIRSIIREQEAQVHNNPRDGEVHLFAG* |
| Ga0115549_10387684 | 3300009074 | Pelagic Marine | LFLENKGQITPEMSVIGDEIKIVIRSIIRQQEEQVQSNPKDGEIHLYAG* |
| Ga0118687_100831611 | 3300009124 | Sediment | VLGDEIKIVIRSIIKKQEEQVHSNPKDGEIHLYAG* |
| Ga0114918_100472251 | 3300009149 | Deep Subsurface | MSVLGDEIKIVIRSIIRKQEEEVHTNPLDGEVHLYAG* |
| Ga0114994_105770223 | 3300009420 | Marine | MSVLGDEIKRVVRSIIREQEEEVLSNLKNGEVHLFAG* |
| Ga0115557_11847773 | 3300009443 | Pelagic Marine | SVLGDEIKVVIRSIIRRQEEEVHSNSRDGEIHLYAG* |
| Ga0115557_12356532 | 3300009443 | Pelagic Marine | MSVLGDEIKVVIRSIIRQQEEEVHNNPRDGEIHLYAG* |
| Ga0115570_102164392 | 3300009496 | Pelagic Marine | MSVLGDEIKRVIRSIIREQEAQVRNNPKDGEIHLFAG* |
| Ga0129345_10988031 | 3300010297 | Freshwater To Marine Saline Gradient | ITAEMSVLGDEIKQTIRSILREQEAKVHTNENDYEVHLYAG* |
| Ga0129345_11074931 | 3300010297 | Freshwater To Marine Saline Gradient | GQITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG* |
| Ga0129345_13277961 | 3300010297 | Freshwater To Marine Saline Gradient | MSVLGDEIKQVIRLIIRKQEAEVHTNPLDGEVHLYAG* |
| Ga0129342_11988343 | 3300010299 | Freshwater To Marine Saline Gradient | MSVLGDEIKQVIRSIIRKQEEEVHINPRDGEIHLYAG* |
| Ga0129342_13092332 | 3300010299 | Freshwater To Marine Saline Gradient | VIGDEIKTVIRSIIRQQEEQVQTNPLNGEIHLYAG* |
| Ga0136655_10802784 | 3300010316 | Freshwater To Marine Saline Gradient | LGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG* |
| Ga0129324_101702413 | 3300010368 | Freshwater To Marine Saline Gradient | MSVLGDEIKRVIRSIIREQEAKVQVNEKDYEVHLF |
| Ga0136852_113069521 | 3300010412 | Mangrove Sediment | ITAEMSALGDEIKQVIRSIIREQENRVQTNPRDGEIHLYAG* |
| Ga0129353_10919841 | 3300012525 | Aqueous | WNELFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG* |
| Ga0129327_102923952 | 3300013010 | Freshwater To Marine Saline Gradient | SVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG* |
| Ga0182088_10235891 | 3300016703 | Salt Marsh | QITPEMSVLGDEIKTVIRSIIKQQEEQVRTNPLDGEIHLYAG |
| Ga0180120_1000734410 | 3300017697 | Freshwater To Marine Saline Gradient | EMSVLGDEIKVVIRSIIRRQEEEVHSNSRDGEIHLYAG |
| Ga0181590_101151035 | 3300017967 | Salt Marsh | PEMSVLGDEIKTVIRSIIKQQEEQVRTNPLDGEIHLYAG |
| Ga0181585_107867383 | 3300017969 | Salt Marsh | EMSVLGDEIKNVIRSIIRQQEEQVHSNPRDGEIHFYAG |
| Ga0181585_108192532 | 3300017969 | Salt Marsh | SVIGDEIKTVIRSIIRQQEEQVRTNPKDGEIHLYAG |
| Ga0180432_104275823 | 3300017989 | Hypersaline Lake Sediment | EMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEVHLYAG |
| Ga0181592_101892934 | 3300018421 | Salt Marsh | WNELFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0181592_108603872 | 3300018421 | Salt Marsh | SVLGDEIKQTIRSILREQEAKVHTNENDYEVHLYAG |
| Ga0194002_10542251 | 3300019745 | Sediment | GQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0181599_11382904 | 3300020178 | Salt Marsh | TAEMSVLGDEIKQTIRSILREQEAKVHTNENDYEVHLYAG |
| Ga0181598_12738911 | 3300020810 | Salt Marsh | EMSALGDEIKRVIRSIIREQETKVHTNDKDYEVHLYAG |
| Ga0213858_102938863 | 3300021356 | Seawater | MSVLGDEIKRVIRSIIREQEAQVHNNPRDGEIHLFAG |
| Ga0213868_106687481 | 3300021389 | Seawater | PEMSVLGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0193947_10657821 | 3300021465 | Sediment | SVLGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0222717_100383591 | 3300021957 | Estuarine Water | AEMSVIGDEIKTVIRSIIRQQEEQVQTNPRDGEIHLYAG |
| Ga0222718_101741973 | 3300021958 | Estuarine Water | MSVLGDEIKTVIRSIIKQQEEQVQTNPLDGEIHLYAG |
| Ga0222718_101789611 | 3300021958 | Estuarine Water | VLGDEIKQTIRSILRAQEAEVHTNPKDGEIHLYAG |
| Ga0196895_10134601 | 3300022067 | Aqueous | TELFLENKGQITPEMSVIGDEIKIVIRSIIRQQEEQVQSNPKDGEIHLYAG |
| Ga0212021_10892741 | 3300022068 | Aqueous | RSVLGDEIKQTIRSILRAQEAKVHTNPLDGEVHLYAG |
| Ga0212027_10190203 | 3300022168 | Aqueous | VLGDEIKVVIRSIIRRQEEEVHSNSRDGEIHLYAG |
| Ga0196899_11524043 | 3300022187 | Aqueous | EMSVLGDEIKNVIRSIIRQQEEQVHSNPRDGEIHLYAG |
| Ga0196905_10365044 | 3300022198 | Aqueous | EMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0196901_10789781 | 3300022200 | Aqueous | GQITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0222653_10419513 | 3300022857 | Saline Water | VLGDEIKIVIRLIIREQEIQANTNGRDYEEHLFAG |
| Ga0255772_105940641 | 3300023176 | Salt Marsh | SVLGDEIKTVIRSIIKQQEEQVRTNPLDGEIHLYAG |
| Ga0233398_11079003 | 3300024320 | Seawater | PEMSVLGDEIKNVIRSIIRQQEEQVHSNPRDGEIHLYAG |
| Ga0208303_10365534 | 3300025543 | Aqueous | AEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0209094_10319674 | 3300025594 | Pelagic Marine | MSVLGDEIKRVIRSIIAEQEAKVHNNPRDGEIHLYAG |
| Ga0208149_10593931 | 3300025610 | Aqueous | EMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208428_10823632 | 3300025653 | Aqueous | ELFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208428_11055372 | 3300025653 | Aqueous | QITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208898_10896612 | 3300025671 | Aqueous | KGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208150_11281661 | 3300025751 | Aqueous | KGQITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0208899_12023363 | 3300025759 | Aqueous | TPEMSVLGDEIKTVIRSIIKQQEEQVRTNPLDGEIHLYAG |
| Ga0209137_11923281 | 3300025767 | Marine | MSVLGDEIKKVIRSIIREQEAKVHTNEKDYEVHLFAG |
| Ga0208767_10167031 | 3300025769 | Aqueous | VIGDEIKTVIRSIIRQQEEQVRTNPKDGEIHLYAG |
| Ga0208767_11568221 | 3300025769 | Aqueous | SAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208427_10861391 | 3300025771 | Aqueous | RWNELFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0208427_10910043 | 3300025771 | Aqueous | ITAEMSVIGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0208543_10799912 | 3300025810 | Aqueous | RGQITAEMSVIGDEIKTVIRSIIRQQEEQVQTNPLNGEIHLYAG |
| Ga0208785_10604183 | 3300025815 | Aqueous | ITPEMSVLGDEIKNVIRSIIRQQEEQVRTNPRDGEIHLYAG |
| Ga0208785_11396632 | 3300025815 | Aqueous | AIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0209832_10143901 | 3300025830 | Pelagic Marine | PEMSVLGDEIKRVIRSIIAEQEAKVHNNPRDGEIHLYAG |
| Ga0208917_10918481 | 3300025840 | Aqueous | EMSVLGDEIKTVIRSIIRQQEEQVRTNPLDGEIHLYAG |
| Ga0208645_11533361 | 3300025853 | Aqueous | SVIGDEIKTVIRSIIRQQEEQVQTNPRDGEIHLYAG |
| Ga0209630_101995421 | 3300025892 | Pelagic Marine | SVLGDEIKRVIRSIIREQEAQVHNNPRDGEVHLFAG |
| Ga0209932_10472451 | 3300026183 | Pond Water | AEMSVLGDEIKQVIRSIIRKQEAEVHTNEKDYEVHLYAG |
| Ga0209929_10750033 | 3300026187 | Pond Water | ITPEMSVLGDEIKQTIRSILRAQEAEVRTNPRDGEIHLYAG |
| (restricted) Ga0233414_101173691 | 3300028045 | Seawater | VIGDEIKIVIRSIIRQQEEEVHSNPRDGEIHLYAG |
| Ga0314858_027368_416_529 | 3300033742 | Sea-Ice Brine | MSVLGDEIKVVIRLIIREQEIQANKNSRDYEAHLFAG |
| Ga0314858_029661_1057_1170 | 3300033742 | Sea-Ice Brine | MSVLGDEIKRVVRSIIREQEEEVLSNLKNGEVHLFAG |
| Ga0348335_078360_1014_1121 | 3300034374 | Aqueous | VLGDEIKNVIRSIIRQQEEQVRTNPRDGEIHLYAG |
| Ga0348335_085235_785_898 | 3300034374 | Aqueous | MSVLGDEIKQVIRSIIRKQEAEVHTNPLDGEVHLYAG |
| Ga0348335_098512_75_188 | 3300034374 | Aqueous | MSVLGDEIKTVIRSIIRQQEEQVRTNPRDGEIHLYAG |
| Ga0348336_085764_29_178 | 3300034375 | Aqueous | LFLENKGQITAEMSAIGDEIKHTIRSILKAQETQVHTNPLDGEIHLYAG |
| Ga0348336_112940_3_113 | 3300034375 | Aqueous | SVLGDEIKNVIRSIIRQQEEQVRTNPRDGEIHLYAG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |