| Basic Information | |
|---|---|
| Taxon OID | 3300000932 Open in IMG/M |
| Scaffold ID | JGI12479J12853_1005162 Open in IMG/M |
| Source Dataset Name | Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4182 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Emeryville, CA | |||||||
| Coordinates | Lat. (o) | 37.840854 | Long. (o) | -122.289843 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033243 | Metagenome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI12479J12853_10051621 | F033243 | N/A | QGPIDLVGHGAEPVLAAGYSTLELERAGLTVEKARELGIPVDAGRCSGVGANVMQLRALLTS* |
| ⦗Top⦘ |