3300000932: Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2)

Overview

Basic Information

• IMG/M Taxon OID: 3300000932
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0054299 | Ga0001890
• Sample Name: Aerobic enrichment media microbial communities from Eden Landing Ponds, California, USA - A23 P3 (2)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 101197369
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Engineered
• Taxonomy: Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Emeryville, CA
• Coordinates
  • Lat. (^o): 37.840854
  • Long. (^o): -122.289843
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033243	Metagenome	178	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12479J12853_1005162	All Organisms → cellular organisms → Bacteria → Proteobacteria	4182

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12479J12853_1005162	JGI12479J12853_10051621	F033243	QGPIDLVGHGAEPVLAAGYSTLELERAGLTVEKARELGIPVDAGRCSGVGANVMQLRALLTS*