Scaffold NpDRAFT_10042037

Overview

Basic Information

• Taxon OID: 3300000929
• Scaffold ID: NpDRAFT_10042037
• Source Dataset Name: Marine plume microbial communities from the Columbia River - 15 PSU
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2641
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktomarina → Planktomarina temperata → Planktomarina temperata RCA23 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River plume, coastal ocean
• Coordinates
  • Lat. (^o): 46.239
  • Long. (^o): -124.161
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055542	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
NpDRAFT_100420373	F055542	AGG	MNKRFKPQYLPYNDDAEALVESLAAELQLTLKDKTGAKHRTILSSF