NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OpTDRAFT_10264265

Scaffold OpTDRAFT_10264265


Overview

Basic Information
Taxon OID3300000928 Open in IMG/M
Scaffold IDOpTDRAFT_10264265 Open in IMG/M
Source Dataset NameMarine plume microbial communities from the Columbia River - 25 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1132
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River plume, coastal ocean
CoordinatesLat. (o)46.233Long. (o)-124.16Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041775Metagenome / Metatranscriptome159Y
F090995Metagenome108Y

Sequences

Protein IDFamilyRBSSequence
OpTDRAFT_102642654F041775N/AMYLNDPNHLQVQDIDSIEANELVMAFIHDNMIEPMTDNNMLDNDQLSMLNVIGGALKAIAQKAHAYETLTESQDSSHYRN*
OpTDRAFT_102642655F090995N/AIMKAKKIKIRQSILFTKARPFKMKNKILDRKLKHKTKLNYVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.