Scaffold JGI12277J12856_1004548

Overview

Basic Information

• Taxon OID: 3300000911
• Scaffold ID: JGI12277J12856_1004548
• Source Dataset Name: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1830
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Hot Lake, Oroville, Washington, USA
• Coordinates
  • Lat. (^o): 48.973481
  • Long. (^o): -119.476345
  • Depth (m): .35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064603	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12277J12856_10045486	F064603	N/A	MEIKKIDYSKSTEDIFYKILYPIYAREFLFGDDYESFALTISANFILNSKQWDCILKHWEEKETILTNEELFNS