3300000911: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #5

Overview

Basic Information

• IMG/M Taxon OID: 3300000911
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0054702 | Ga0002832
• Sample Name: Hypersaline microbial mat communities from Hot Lake, Washington, USA - Section #5
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 48989163
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hypersaline lake → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Hot Lake, Oroville, Washington, USA
• Coordinates
  • Lat. (^o): 48.973481
  • Long. (^o): -119.476345
  • Alt. (m): N/A
  • Depth (m): .35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064603	Metagenome / Metatranscriptome	128	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12277J12856_1004548	All Organisms → Viruses → Predicted Viral	1830

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12277J12856_1004548	JGI12277J12856_10045486	F064603	MEIKKIDYSKSTEDIFYKILYPIYAREFLFGDDYESFALTISANFILNSKQWDCILKHWEEKETILTNEELFNS