| Basic Information | |
|---|---|
| Taxon OID | 3300000900 Open in IMG/M |
| Scaffold ID | diamDraft_1025462 Open in IMG/M |
| Source Dataset Name | Diamante Lake Red Biofilm |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | INDEAR Instituto de Agrobiotecnologia Rosario |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 576 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → unclassified Halorubrum → Halorubrum sp. 48-1-W | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Microbial Mats → Red Biofilm → Red Biofilm Microbial Communities From Diamante Lake, Argentina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Argentina: Catamarca Province | |||||||
| Coordinates | Lat. (o) | -26.034111 | Long. (o) | -67.039458 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062489 | Metagenome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| diamDraft_10254622 | F062489 | AGGAGG | VTGPDAIILRERVAEGPTRRIVWHPLTTGGYERREQLWRQSIEGWHTTGTEIVTDLTIDRPEGRR* |
| ⦗Top⦘ |