3300000900: Diamante Lake Red Biofilm

Overview

Basic Information

• IMG/M Taxon OID: 3300000900
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0085306 | Gp0056048 | Ga0011715
• Sample Name: Diamante Lake Red Biofilm
• Sequencing Status: Permanent Draft
• Sequencing Center: INDEAR Instituto de Agrobiotecnologia Rosario
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 42651092
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → unclassified Halorubrum → Halorubrum sp. 48-1-W	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Red Biofilm Microbial Communities From Diamante Lake, Argentina
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Microbial Mats → Red Biofilm → Red Biofilm Microbial Communities From Diamante Lake, Argentina

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Surface (non-saline)

Location Information

• Location: Argentina: Catamarca Province
• Coordinates
  • Lat. (^o): -26.034111
  • Long. (^o): -67.039458
  • Alt. (m): N/A
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062489	Metagenome	130	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
diamDraft_1025462	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → unclassified Halorubrum → Halorubrum sp. 48-1-W	576

Sequences

Scaffold ID	Protein ID	Family	Sequence
diamDraft_1025462	diamDraft_10254622	F062489	VTGPDAIILRERVAEGPTRRIVWHPLTTGGYERREQLWRQSIEGWHTTGTEIVTDLTIDRPEGRR*