NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FwDRAFT_10050159

Scaffold FwDRAFT_10050159


Overview

Basic Information
Taxon OID3300000882 Open in IMG/M
Scaffold IDFwDRAFT_10050159 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Columbia River
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)645
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River freshwater tidal region
CoordinatesLat. (o)46.18Long. (o)-123.18Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007468Metagenome / Metatranscriptome350Y
F059952Metagenome / Metatranscriptome133N
F062746Metagenome / Metatranscriptome130Y

Sequences

Protein IDFamilyRBSSequence
FwDRAFT_100501591F007468GGAGGLTTQTKSSKFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIM
FwDRAFT_100501592F062746N/APSDLMDKEPLRKDLEDAVSFLQGLWAEGYFDYTN*
FwDRAFT_100501593F059952N/AQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.