| Basic Information | |
|---|---|
| Family ID | F059952 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | EDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 63.16 % |
| % of genes from short scaffolds (< 2000 bps) | 56.39 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (54.887 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (20.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.361 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.880 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.68% β-sheet: 0.00% Coil/Unstructured: 55.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF02675 | AdoMet_dc | 1.50 |
| PF04973 | NMN_transporter | 0.75 |
| PF06067 | DUF932 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.50 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.91 % |
| Unclassified | root | N/A | 36.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000268|M3P_10114203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300000882|FwDRAFT_10050159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300000929|NpDRAFT_10058271 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300003413|JGI25922J50271_10068627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300003429|JGI25914J50564_10124488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300003490|JGI25926J51410_1087685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300003493|JGI25923J51411_1044157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300003497|JGI25925J51416_10162007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300005517|Ga0070374_10332026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300005517|Ga0070374_10382017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300005581|Ga0049081_10084461 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300005584|Ga0049082_10292671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300005662|Ga0078894_10746221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300005662|Ga0078894_10932471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300005662|Ga0078894_11143491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300005662|Ga0078894_11475921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300006484|Ga0070744_10134300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300006484|Ga0070744_10207656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300006484|Ga0070744_10219574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300006641|Ga0075471_10663149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300007162|Ga0079300_10183536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300007165|Ga0079302_1067349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300007544|Ga0102861_1215307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300007549|Ga0102879_1018860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2313 | Open in IMG/M |
| 3300007555|Ga0102817_1087487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300007559|Ga0102828_1025449 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300007559|Ga0102828_1041940 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300007562|Ga0102915_1318345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300007603|Ga0102921_1012310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3177 | Open in IMG/M |
| 3300007617|Ga0102897_1111052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300007621|Ga0102872_1070076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300008107|Ga0114340_1048198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
| 3300008107|Ga0114340_1159811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300008107|Ga0114340_1204407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300008107|Ga0114340_1218319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300008107|Ga0114340_1224987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300008107|Ga0114340_1262051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300008108|Ga0114341_10371111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300008110|Ga0114343_1183631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300008111|Ga0114344_1025619 | All Organisms → Viruses → Predicted Viral | 2989 | Open in IMG/M |
| 3300008111|Ga0114344_1235528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300008120|Ga0114355_1147804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300008261|Ga0114336_1009674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8749 | Open in IMG/M |
| 3300008266|Ga0114363_1039243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4251 | Open in IMG/M |
| 3300009068|Ga0114973_10334690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300009068|Ga0114973_10392386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300009068|Ga0114973_10631042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300009159|Ga0114978_10679450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300009163|Ga0114970_10006302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8498 | Open in IMG/M |
| 3300009181|Ga0114969_10403899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300011184|Ga0136709_1031570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300012663|Ga0157203_1032860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300012726|Ga0157597_1299074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300013004|Ga0164293_10504536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300013005|Ga0164292_10197867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300017766|Ga0181343_1154563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300020205|Ga0211731_10542380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300020562|Ga0208597_1071016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300021961|Ga0222714_10381625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300021962|Ga0222713_10066632 | All Organisms → Viruses → Predicted Viral | 2680 | Open in IMG/M |
| 3300021962|Ga0222713_10105943 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300021963|Ga0222712_10023207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5093 | Open in IMG/M |
| 3300021963|Ga0222712_10600905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300024346|Ga0244775_10441374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300024348|Ga0244776_10695533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300027186|Ga0208797_1019316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300027205|Ga0208926_1056603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300027221|Ga0208557_1067458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300027242|Ga0208806_1077692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300027529|Ga0255077_1077382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300027581|Ga0209651_1047482 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300027679|Ga0209769_1116585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300027689|Ga0209551_1183757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300027732|Ga0209442_1204169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027782|Ga0209500_10389845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300027793|Ga0209972_10150371 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300027793|Ga0209972_10235022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300027793|Ga0209972_10334040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300031784|Ga0315899_11081411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300031787|Ga0315900_10371788 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300031857|Ga0315909_10526293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300032116|Ga0315903_10121916 | All Organisms → Viruses → Predicted Viral | 2445 | Open in IMG/M |
| 3300032116|Ga0315903_10809355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300034063|Ga0335000_0635959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300034093|Ga0335012_0139342 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 20.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 12.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.52% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.51% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.76% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.01% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.50% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.50% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.75% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027186 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027240 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_101142031 | 3300000268 | Lotic | DWINSNLDEGQYYADKQFAEMSGDKFVQSEFNKFYNLTEGDEDYFE* |
| FwDRAFT_100501593 | 3300000882 | Freshwater And Marine | QDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC* |
| NpDRAFT_100582715 | 3300000929 | Freshwater And Marine | EDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC* |
| JGI25922J50271_100686271 | 3300003413 | Freshwater Lake | EQLLENWINSNXEEGQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| JGI25914J50564_101244884 | 3300003429 | Freshwater Lake | DEGQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| JGI25926J51410_10876851 | 3300003490 | Freshwater Lake | AVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYEIKEGDEDYL* |
| JGI25923J51411_10441571 | 3300003493 | Freshwater Lake | LLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYEIKEGDEDYL* |
| JGI25925J51416_101140033 | 3300003497 | Freshwater Lake | SNLDEGQYYADKQFAWMSDDKFIQSEFNKFYNLTEIDEDYFE* |
| JGI25925J51416_101620071 | 3300003497 | Freshwater Lake | NLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGEEGYLE* |
| Ga0066177_104444203 | 3300004096 | Freshwater Lake | NNLDEGQYYADKQFAEMSGDEFIYAEFNKFYELKEGDEDYLC* |
| Ga0070374_102602385 | 3300005517 | Freshwater Lake | EDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0070374_103320261 | 3300005517 | Freshwater Lake | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC* |
| Ga0070374_103820171 | 3300005517 | Freshwater Lake | YYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYFE* |
| Ga0049081_100844611 | 3300005581 | Freshwater Lentic | DIAEQLLDDWINSNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0049080_100548731 | 3300005582 | Freshwater Lentic | YQDIAEQLLDDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYNLKEGDEDYLC* |
| Ga0049082_102926711 | 3300005584 | Freshwater Lentic | LDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0078894_107462215 | 3300005662 | Freshwater Lake | QYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEDYLC* |
| Ga0078894_109324715 | 3300005662 | Freshwater Lake | YADKQFAEMSGDKFIQDEFNKFYELKEGDEGYIC* |
| Ga0078894_111434914 | 3300005662 | Freshwater Lake | LDEGQYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEDYLC* |
| Ga0078894_114759211 | 3300005662 | Freshwater Lake | YADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC* |
| Ga0070743_101103115 | 3300005941 | Estuarine | CYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFVQSEFNKFYELKEGDEGYIDIL* |
| Ga0070744_101343001 | 3300006484 | Estuarine | GQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC* |
| Ga0070744_102076564 | 3300006484 | Estuarine | YYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0070744_102195741 | 3300006484 | Estuarine | EDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0075471_106631491 | 3300006641 | Aqueous | YQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0079300_101835361 | 3300007162 | Deep Subsurface | AEQLLEDWINSNLDEGQYYADKQFAEMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| Ga0079302_10673491 | 3300007165 | Deep Subsurface | CYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| Ga0102861_12153073 | 3300007544 | Estuarine | EGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC* |
| Ga0102873_11452621 | 3300007545 | Estuarine | GQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| Ga0102879_10188608 | 3300007549 | Estuarine | YQEIAEQLLDDWINSNLEEGQYYADRQFALMSSDSYIQSEFNKFYELNPTDEGYIEC* |
| Ga0102879_11736504 | 3300007549 | Estuarine | EQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0102817_10874871 | 3300007555 | Estuarine | YYADKQFAEMSGDKFVQSEFNKFYNLKEGDEDYLC* |
| Ga0102828_10254497 | 3300007559 | Estuarine | DEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYIC* |
| Ga0102828_10419401 | 3300007559 | Estuarine | YYADKQFAEMSGDKFIQDEFNKFYDIKEGDEGYLC* |
| Ga0102915_13183451 | 3300007562 | Estuarine | VYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0102921_101231010 | 3300007603 | Estuarine | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0102897_11110521 | 3300007617 | Estuarine | AEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0102872_10700761 | 3300007621 | Estuarine | YYADKQFAEMSGDEFIQGEFNKFYNLKEGDEDYLC* |
| Ga0102906_12175343 | 3300007637 | Estuarine | QWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0102898_10632791 | 3300007658 | Estuarine | QYYADKQFAEMSGDKFIQDEFNKFYNIKEGDEDYLC* |
| Ga0105746_10648291 | 3300007973 | Estuary Water | EQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0105747_100800410 | 3300007974 | Estuary Water | EGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0105748_104912881 | 3300007992 | Estuary Water | DWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0114340_10481981 | 3300008107 | Freshwater, Plankton | QDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYELKEGDEGYLC* |
| Ga0114340_11598111 | 3300008107 | Freshwater, Plankton | LDEGQYYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC* |
| Ga0114340_12044071 | 3300008107 | Freshwater, Plankton | QDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYAEFNKFYNLKEGDEGYLC* |
| Ga0114340_12183191 | 3300008107 | Freshwater, Plankton | NWINSNLEEGQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDYFE* |
| Ga0114340_12249874 | 3300008107 | Freshwater, Plankton | QYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0114340_12620511 | 3300008107 | Freshwater, Plankton | GQYYADKQFAEMSGDEFIQGEFNKFYNLKEGDEDYLC* |
| Ga0114341_103711111 | 3300008108 | Freshwater, Plankton | NLDEGQYYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC* |
| Ga0114343_11836311 | 3300008110 | Freshwater, Plankton | EGQYYADKQFAEMSGDEFIQGEFNKFYNLKEGDEDYLC* |
| Ga0114344_102561912 | 3300008111 | Freshwater, Plankton | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYSLKEGDEDYL* |
| Ga0114344_12355281 | 3300008111 | Freshwater, Plankton | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYNLKEGDEDYL* |
| Ga0114344_12512803 | 3300008111 | Freshwater, Plankton | IAEQLLEDWINSNLDEGQYYADKQFAEMSGDKFVQQEFNKFYELKEGDEDYFE* |
| Ga0114346_10835761 | 3300008113 | Freshwater, Plankton | QDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0114346_12436571 | 3300008113 | Freshwater, Plankton | EDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0114355_11478041 | 3300008120 | Freshwater, Plankton | LDDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0114355_12047421 | 3300008120 | Freshwater, Plankton | NLDEGQYYADKQFAEMSGDRFIQDEFNKFYNLKEGDEDYL* |
| Ga0114336_100967428 | 3300008261 | Freshwater, Plankton | NLDEGQYYADKQFAEMSGDEFIYGEFNKFYNLKEGDEDYLC* |
| Ga0114363_103924314 | 3300008266 | Freshwater, Plankton | EGQYYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC* |
| Ga0102816_12996411 | 3300008999 | Estuarine | NNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0102864_11606821 | 3300009051 | Estuarine | DEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE* |
| Ga0102830_100354422 | 3300009059 | Estuarine | INNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYFEQV* |
| Ga0114973_103346901 | 3300009068 | Freshwater Lake | GQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0114973_103923864 | 3300009068 | Freshwater Lake | QDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEGYLC* |
| Ga0114973_106310421 | 3300009068 | Freshwater Lake | YYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDFFEC* |
| Ga0114980_104797591 | 3300009152 | Freshwater Lake | EDWINNNLDEGQYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEDYLC* |
| Ga0114978_106794501 | 3300009159 | Freshwater Lake | EQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC* |
| Ga0114978_108203451 | 3300009159 | Freshwater Lake | DIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC* |
| Ga0114970_1000630215 | 3300009163 | Freshwater Lake | LTLYQEIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC* |
| Ga0114969_103276155 | 3300009181 | Freshwater Lake | DWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC* |
| Ga0114969_104038991 | 3300009181 | Freshwater Lake | NLDEGQYYADKQFAEMSGDKFIQDEFNKFYNLTPIDEDYFE* |
| Ga0139557_10277185 | 3300011010 | Freshwater | DIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFIQSEFNKFYNLNEGDEDYFE* |
| Ga0136709_10315705 | 3300011184 | Freshwater | YYADKQFAEMSGDKFVQSEFNKFYNLNEGDEDYFE* |
| Ga0157203_10328604 | 3300012663 | Freshwater | NWINSNLEEGQYYADKQFAWMSDDKFIQSEFNKFYNLTEIDEDYFEIL* |
| Ga0157597_12990741 | 3300012726 | Freshwater | LLEDWINNNLDEGQYYADKQFAEMSGDEFIYGEFNKFYNLKEGDEDYLC* |
| Ga0164293_105045364 | 3300013004 | Freshwater | GQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC* |
| Ga0164293_107877994 | 3300013004 | Freshwater | DDWMNSNLDEGQYFADKRFAEMSGDKFIYDEFNKHYKLTEEDEDYLC* |
| Ga0164292_101978671 | 3300013005 | Freshwater | QYYADKQFAEMSGDEFIQSEFNKFYNLTEIDEDYFEIL* |
| Ga0181343_11545634 | 3300017766 | Freshwater Lake | LDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLCKDIQKRI |
| Ga0211731_105423805 | 3300020205 | Freshwater | QYYADKQFAEMSGDRFIQDEFNKFYELKEGDEGYL |
| Ga0208597_10710163 | 3300020562 | Freshwater | DIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFIQSEFNKFYNLKEGDEDYFE |
| Ga0208053_10500174 | 3300020575 | Freshwater | AEQLLEDWINNNLDEGQYYADKQFAEMSGDEFIYGEFNKFYNLKEGDEDYLC |
| Ga0222714_103816254 | 3300021961 | Estuarine Water | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNIKEGDEDYLC |
| Ga0222713_1006663211 | 3300021962 | Estuarine Water | DEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0222713_101059431 | 3300021962 | Estuarine Water | AVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNIKEGDEDYLC |
| Ga0222712_1002320718 | 3300021963 | Estuarine Water | INNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNIKEGDEDYLC |
| Ga0222712_106009051 | 3300021963 | Estuarine Water | IAEQLLEDWLNNNLDEGQYFADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC |
| Ga0244775_104413745 | 3300024346 | Estuarine | LLEDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC |
| Ga0244775_106288951 | 3300024346 | Estuarine | EGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC |
| Ga0244776_106955334 | 3300024348 | Estuarine | AEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC |
| Ga0208797_10193161 | 3300027186 | Estuarine | YYADKQFAEMSGDKFIQDEFNKFYDIKEGDEGYLC |
| Ga0208921_10685532 | 3300027188 | Estuarine | EQWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYFEQV |
| Ga0208800_10123835 | 3300027193 | Estuarine | QLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEGYLC |
| Ga0208926_10566034 | 3300027205 | Estuarine | YYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYLC |
| Ga0208557_10674583 | 3300027221 | Estuarine | IAEQLLDDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC |
| Ga0208444_10464101 | 3300027240 | Estuarine | LEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYNIKEGDEDYLC |
| Ga0208806_10140998 | 3300027242 | Estuarine | NLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE |
| Ga0208806_10776921 | 3300027242 | Estuarine | WINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYNIKEGDEDYLC |
| Ga0208311_10308891 | 3300027387 | Estuarine | IAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKQGDEGYLE |
| Ga0255077_10773821 | 3300027529 | Freshwater | NNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDVKEGDEDYLC |
| Ga0209552_11591654 | 3300027563 | Freshwater Lake | NLDEGQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDYFE |
| Ga0209651_10474826 | 3300027581 | Freshwater Lake | INNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEGYLC |
| Ga0208974_10876464 | 3300027608 | Freshwater Lentic | VYQDIAEQLLDDWINSNLDEGQYYADKQFAEMSGDKFIQDEFNKFYNIKEGDEDYLC |
| Ga0209357_10810595 | 3300027656 | Freshwater Lake | GQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC |
| Ga0209769_11165851 | 3300027679 | Freshwater Lake | VYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEGYLC |
| Ga0209551_11837574 | 3300027689 | Freshwater Lake | INNNLDEGQYYADKQFAEMSGDEFIYGEFNKFYNLKEGDEDYLC |
| Ga0209442_12041694 | 3300027732 | Freshwater Lake | LLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC |
| Ga0208305_1001681711 | 3300027753 | Estuarine | LLEQWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYELKEGDEDYFEQV |
| Ga0209770_102008125 | 3300027769 | Freshwater Lake | YYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC |
| Ga0209500_103898451 | 3300027782 | Freshwater Lake | EIAEQLLENWINSNLEEGQYYADKQFAWMSDDKFIQSEFNKFYNLTPIDEDFFEC |
| Ga0209972_101503711 | 3300027793 | Freshwater Lake | EDWINSNLDEGQYYADKQFAEMSGDKFVQQEFNKFYELKEGDEDYFE |
| Ga0209972_102350221 | 3300027793 | Freshwater Lake | LDEGQYYADKQFAEMSGDRFIQDEFNKFYNLKEGDEDYL |
| Ga0209972_103340404 | 3300027793 | Freshwater Lake | GQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0209400_10594951 | 3300027963 | Freshwater Lake | DWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDEDYLC |
| Ga0247723_101100911 | 3300028025 | Deep Subsurface Sediment | AEQLLEDWINNNLDEGQYYADKQFAEMSGDEFIYNEFNKFYNLKEGDEDYLC |
| Ga0247723_10557031 | 3300028025 | Deep Subsurface Sediment | LLENWINSNLEEGQYYADKQFAWMSDDKFIQSEFNKFYNLTEIDEDYFDIL |
| Ga0315899_110814111 | 3300031784 | Freshwater | INNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0315899_115701281 | 3300031784 | Freshwater | AEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0315900_103717886 | 3300031787 | Freshwater | INNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLE |
| Ga0315909_105262931 | 3300031857 | Freshwater | DIAEQLLDDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0315909_108084334 | 3300031857 | Freshwater | INNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYELKEGDEDYLC |
| Ga0315904_108024355 | 3300031951 | Freshwater | IAEQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYSLKEGDEDYL |
| Ga0315906_106487711 | 3300032050 | Freshwater | QDIAEQLLDDWINNNLDEGQYYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC |
| Ga0315906_107637255 | 3300032050 | Freshwater | EQLLEDWINNNLDEGQYYADKQFAEMSGDRFIQDEFNKFYNLKEGDEDYL |
| Ga0315903_101219161 | 3300032116 | Freshwater | GQYYADKQFAEMSGDEFIYAEFNKFYNLKEGDEDYLC |
| Ga0315903_108093554 | 3300032116 | Freshwater | LEDWINSNLDEGQYYADKQFAEMSGDKFVQQEFNKFYELKEGDEDYFE |
| Ga0335002_0061806_2551_2658 | 3300034020 | Freshwater | YYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0334995_0766088_409_531 | 3300034062 | Freshwater | LDEGQYYADKQFAEMSGDEFIQSEFNKFYNLKEGDEDYFE |
| Ga0335000_0635959_447_593 | 3300034063 | Freshwater | LDDWINSNLDEGQYYADKQFAEMSVDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0335028_0584406_459_602 | 3300034071 | Freshwater | DDWINNNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| Ga0335012_0139342_1176_1328 | 3300034093 | Freshwater | LEDWINNNLDEGQYYADKQFAEMSGDKFVQSEFNKFYNLTEGDEDYFEQV |
| Ga0335048_0038256_3_143 | 3300034356 | Freshwater | DWINSNLDEGQYYADKQFAEMSGDKFIYDEFNKFYNLKEGDEDYLC |
| ⦗Top⦘ |