| Basic Information | |
|---|---|
| Taxon OID | 3300000866 Open in IMG/M |
| Scaffold ID | JzSedJan11_1014421 Open in IMG/M |
| Source Dataset Name | Hot spring sediment from Jinze in Tengchong, China |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5244 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Springs Sediment → Hot Springs Sediment Microbial Communities From Tengchong, China, Analyzing Pire Metagenomes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baoshan, Yunnan, China | |||||||
| Coordinates | Lat. (o) | 25.44138 | Long. (o) | 98.46004 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025877 | Metagenome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JzSedJan11_10144219 | F025877 | N/A | MPGLDETENTFRYRVQNPDKFDRFRVKEITHGVKITLGRVKGTSRWEIQNYIFDKKLFRTREQVQKWLEKHLKSEVKTLLDFNAWNEHRKRLLQVYLEISKIA* |
| ⦗Top⦘ |