Basic Information | |
---|---|
Taxon OID | 3300000787 Open in IMG/M |
Scaffold ID | JGI11643J11755_10539945 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | .1016 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103863 | Metagenome / Metatranscriptome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI11643J11755_105399451 | F103863 | N/A | CISYIRNEVDSHILNSKNTLNVLHSSKQRKAVIITGAILLIVGFIGAVTIGTMVINDTANNNLTPQGYPKTEFLGISAFSYEYGSVFTAVLGMFVLIGGLFGMDSKKKEN* |
⦗Top⦘ |