Scaffold JGI12340J11893_102411

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12340J11893_102411

Scaffold JGI12340J11893_102411

Overview

Basic Information
Taxon OID	3300000701 Open in IMG/M
Scaffold ID	JGI12340J11893_102411 Open in IMG/M
Source Dataset Name	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	585
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location Name	Luquillo Experimental Forest Soil, Puerto Rico
Coordinates	Lat. (^o)	18.0	Long. (^o)	-65.0	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078614	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12340J11893_1024111	F078614	N/A	LLLFGLSPVVREVLQLSRLLKIFEIYENEQQALSA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.