| Basic Information | |
|---|---|
| Family ID | F078614 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 38 residues |
| Representative Sequence | GSRLILFGLSPAVREVLQLSRLQKIFEIYDNEEQALAS |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.86 % |
| % of genes near scaffold ends (potentially truncated) | 98.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.069 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 12.12% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02405 | MlaE | 67.24 |
| PF00005 | ABC_tran | 11.21 |
| PF01548 | DEDD_Tnp_IS110 | 1.72 |
| PF02470 | MlaD | 1.72 |
| PF14685 | Tricorn_PDZ | 0.86 |
| PF04519 | Bactofilin | 0.86 |
| PF13460 | NAD_binding_10 | 0.86 |
| PF02371 | Transposase_20 | 0.86 |
| PF08388 | GIIM | 0.86 |
| PF04542 | Sigma70_r2 | 0.86 |
| PF01740 | STAS | 0.86 |
| PF07676 | PD40 | 0.86 |
| PF13581 | HATPase_c_2 | 0.86 |
| PF00903 | Glyoxalase | 0.86 |
| PF01565 | FAD_binding_4 | 0.86 |
| PF08031 | BBE | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 67.24 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.59 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.86 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.86 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.86 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.86 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.86 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.69 % |
| Unclassified | root | N/A | 29.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000701|JGI12340J11893_102411 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300004091|Ga0062387_100520135 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300004092|Ga0062389_104977983 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005602|Ga0070762_10031756 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
| 3300005764|Ga0066903_102529469 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300005764|Ga0066903_105039138 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006102|Ga0075015_100702011 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006642|Ga0075521_10561068 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006806|Ga0079220_10696820 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006914|Ga0075436_101276174 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300007788|Ga0099795_10101235 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300009088|Ga0099830_10435568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1064 | Open in IMG/M |
| 3300009088|Ga0099830_11211487 | Not Available | 627 | Open in IMG/M |
| 3300009090|Ga0099827_10230511 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300010048|Ga0126373_10216429 | Not Available | 1866 | Open in IMG/M |
| 3300010048|Ga0126373_10961633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300010048|Ga0126373_11194918 | Not Available | 827 | Open in IMG/M |
| 3300010048|Ga0126373_11365867 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010159|Ga0099796_10030879 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300010335|Ga0134063_10055272 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300010341|Ga0074045_10764925 | Not Available | 611 | Open in IMG/M |
| 3300010343|Ga0074044_11111635 | Not Available | 517 | Open in IMG/M |
| 3300010358|Ga0126370_10515649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300010359|Ga0126376_10233822 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300010359|Ga0126376_10378456 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300010361|Ga0126378_11524248 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300010361|Ga0126378_12962020 | Not Available | 541 | Open in IMG/M |
| 3300010376|Ga0126381_102694636 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012096|Ga0137389_10288128 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012189|Ga0137388_10220515 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300012203|Ga0137399_10004936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7222 | Open in IMG/M |
| 3300012210|Ga0137378_10268336 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300012357|Ga0137384_10827337 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012923|Ga0137359_10968212 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012923|Ga0137359_11441427 | Not Available | 577 | Open in IMG/M |
| 3300012924|Ga0137413_10007037 | All Organisms → cellular organisms → Bacteria | 5262 | Open in IMG/M |
| 3300012924|Ga0137413_11492698 | Not Available | 549 | Open in IMG/M |
| 3300012925|Ga0137419_10525873 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012925|Ga0137419_11039013 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014657|Ga0181522_10307295 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300015051|Ga0137414_1057639 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300015053|Ga0137405_1049471 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300016294|Ga0182041_11727924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300016319|Ga0182033_10404872 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300016341|Ga0182035_11218799 | Not Available | 672 | Open in IMG/M |
| 3300016371|Ga0182034_11823268 | Not Available | 536 | Open in IMG/M |
| 3300016422|Ga0182039_10096340 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300016422|Ga0182039_10621501 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300016422|Ga0182039_11271847 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300016422|Ga0182039_11278666 | Not Available | 664 | Open in IMG/M |
| 3300016445|Ga0182038_11803876 | Not Available | 552 | Open in IMG/M |
| 3300017823|Ga0187818_10168817 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300017934|Ga0187803_10443732 | Not Available | 529 | Open in IMG/M |
| 3300017972|Ga0187781_11230697 | Not Available | 551 | Open in IMG/M |
| 3300017994|Ga0187822_10174447 | Not Available | 704 | Open in IMG/M |
| 3300018046|Ga0187851_10691303 | Not Available | 575 | Open in IMG/M |
| 3300018088|Ga0187771_11031568 | Not Available | 698 | Open in IMG/M |
| 3300018090|Ga0187770_10009244 | All Organisms → cellular organisms → Bacteria | 6175 | Open in IMG/M |
| 3300018090|Ga0187770_10702499 | Not Available | 807 | Open in IMG/M |
| 3300020012|Ga0193732_1047563 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300020580|Ga0210403_11352982 | Not Available | 541 | Open in IMG/M |
| 3300020581|Ga0210399_10932545 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300020583|Ga0210401_11545163 | Not Available | 521 | Open in IMG/M |
| 3300021046|Ga0215015_11084793 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300021170|Ga0210400_10413174 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300021178|Ga0210408_10153572 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300021178|Ga0210408_10288337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300021181|Ga0210388_10331059 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300021181|Ga0210388_10535754 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300021181|Ga0210388_11799729 | Not Available | 505 | Open in IMG/M |
| 3300021401|Ga0210393_10077322 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300021402|Ga0210385_10810571 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021403|Ga0210397_10512222 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300021420|Ga0210394_10242866 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300021432|Ga0210384_11788057 | Not Available | 520 | Open in IMG/M |
| 3300024290|Ga0247667_1001132 | All Organisms → cellular organisms → Bacteria | 6092 | Open in IMG/M |
| 3300026361|Ga0257176_1047495 | Not Available | 673 | Open in IMG/M |
| 3300026527|Ga0209059_1229034 | Not Available | 623 | Open in IMG/M |
| 3300026824|Ga0207723_102785 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300026908|Ga0207787_1007477 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300026941|Ga0207741_1010760 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300027381|Ga0208983_1082244 | Not Available | 605 | Open in IMG/M |
| 3300027565|Ga0209219_1035765 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300027574|Ga0208982_1098229 | Not Available | 595 | Open in IMG/M |
| 3300027603|Ga0209331_1006187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3240 | Open in IMG/M |
| 3300027629|Ga0209422_1018372 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300027698|Ga0209446_1126661 | Not Available | 659 | Open in IMG/M |
| 3300027727|Ga0209328_10070342 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300027765|Ga0209073_10444360 | Not Available | 539 | Open in IMG/M |
| 3300027869|Ga0209579_10492832 | Not Available | 665 | Open in IMG/M |
| 3300028146|Ga0247682_1024267 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300028673|Ga0257175_1042441 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300028906|Ga0308309_10209381 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10168300 | Not Available | 606 | Open in IMG/M |
| 3300031250|Ga0265331_10331428 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031543|Ga0318516_10510509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 689 | Open in IMG/M |
| 3300031679|Ga0318561_10429706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 726 | Open in IMG/M |
| 3300031720|Ga0307469_10433776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300031753|Ga0307477_10223118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 1308 | Open in IMG/M |
| 3300031754|Ga0307475_10566621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 910 | Open in IMG/M |
| 3300031823|Ga0307478_10143788 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300031879|Ga0306919_10672102 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300031941|Ga0310912_10271862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300031941|Ga0310912_10932768 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031946|Ga0310910_10225312 | Not Available | 1460 | Open in IMG/M |
| 3300031947|Ga0310909_10884380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300031954|Ga0306926_11378051 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300032001|Ga0306922_10374416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 1526 | Open in IMG/M |
| 3300032001|Ga0306922_11412907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 699 | Open in IMG/M |
| 3300032035|Ga0310911_10082658 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300032043|Ga0318556_10332802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 794 | Open in IMG/M |
| 3300032174|Ga0307470_11743622 | Not Available | 525 | Open in IMG/M |
| 3300032261|Ga0306920_101218650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300032770|Ga0335085_11993366 | Not Available | 589 | Open in IMG/M |
| 3300033547|Ga0316212_1023962 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300034354|Ga0364943_0306794 | Not Available | 601 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.86% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.86% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000701 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12340J11893_1024111 | 3300000701 | Tropical Forest Soil | LLLFGLSPVVREVLQLSRLLKIFEIYENEQQALSA* |
| Ga0062387_1005201351 | 3300004091 | Bog Forest Soil | RDTGMRFALVGLSKGAREVLQLSRLIKIFEIHDNEEQALA* |
| Ga0062389_1049779831 | 3300004092 | Bog Forest Soil | NSSRLILFGLSPSVREVMELSRLQKIFEIYDTEEQALSS* |
| Ga0070762_100317561 | 3300005602 | Soil | ILFGLSTSAREVLQLSRLLKIFEVYDNEEQALAG* |
| Ga0066903_1025294692 | 3300005764 | Tropical Forest Soil | RLLLFGLTPVVREVLQLSRLLKIFEIYENEQQALSA* |
| Ga0066903_1050391382 | 3300005764 | Tropical Forest Soil | ILFGLSPAVKEVMQLSRLQKIFEIYDNEEQALAS* |
| Ga0075015_1007020111 | 3300006102 | Watersheds | SRLILYGLSKSVREVMELSRLQKIFEIHESEAQALGT* |
| Ga0075521_105610681 | 3300006642 | Arctic Peat Soil | RLILYSLSNSVREVMQLSRLQKIFEIFDDEQQALAS* |
| Ga0079220_106968202 | 3300006806 | Agricultural Soil | SRDSGSRLILFGLNSAIREVLQLSKLLRIFEITDTEEQAVAP* |
| Ga0075436_1012761741 | 3300006914 | Populus Rhizosphere | SRFILFGLSPSAREVLQLSRLLKIFEVYEDEAQAIA* |
| Ga0099795_101012351 | 3300007788 | Vadose Zone Soil | RFILIGLSTSAREVLQLSRLIKVFEIYENEEQALAS* |
| Ga0099830_104355681 | 3300009088 | Vadose Zone Soil | RFILFGLSTRAREVLQLSRLIKVFEIYETEDQAAAP* |
| Ga0099830_112114872 | 3300009088 | Vadose Zone Soil | SRLVLFGLNRTVREVLQLSKLVKIFEIYEDEAQSVAP* |
| Ga0099827_102305111 | 3300009090 | Vadose Zone Soil | RDVGSRLILFGLSPIAHEVLQLSRLLKIFEVYDTEDKALEA* |
| Ga0126373_102164292 | 3300010048 | Tropical Forest Soil | LLFGLTPVVREVLQLSRLLKIFEIYENEQQALSA* |
| Ga0126373_109616331 | 3300010048 | Tropical Forest Soil | SRLLLFGLTPVVREVLQLSRLLKIFEIYENEQQALSA* |
| Ga0126373_111949181 | 3300010048 | Tropical Forest Soil | SRDIGSRLLLFGLTPVVREVLQLSRLLKIFEIYENEQQALSA* |
| Ga0126373_113658671 | 3300010048 | Tropical Forest Soil | ASRDTGTRLLLFGLSPSAREVLQLSRLLRIFEVFENEEQALAS* |
| Ga0099796_100308793 | 3300010159 | Vadose Zone Soil | ILFGLSPSAREVLQLSRLLKIFEVYENEDQALAS* |
| Ga0134063_100552723 | 3300010335 | Grasslands Soil | RFILYGLNKTIREVLQLSKLLKIFEIYDNEEQSVAT* |
| Ga0074045_107649252 | 3300010341 | Bog Forest Soil | SRLILYGLTRHVREVMHLARLQTIFEIFEDEQQALDS* |
| Ga0074044_111116352 | 3300010343 | Bog Forest Soil | LFGLSTSAREVLQLSRLLKIFEVYDNEEQALAGEQTISGQ* |
| Ga0126370_105156493 | 3300010358 | Tropical Forest Soil | LILFGLSPAVKEVMQLSRLQKIFEIYDNEEQALAS* |
| Ga0126376_102338223 | 3300010359 | Tropical Forest Soil | ILFGLSTFAREVLQLSRLMKVFEVYENEEQAMAS* |
| Ga0126376_103784563 | 3300010359 | Tropical Forest Soil | CGLSKSAREVLQLSRLIKLFEIYDNEQQALSVNGA* |
| Ga0126378_115242482 | 3300010361 | Tropical Forest Soil | SRLILYGLNTTVREVLQLSKLIRIFEVFDNEEQAVA* |
| Ga0126378_129620201 | 3300010361 | Tropical Forest Soil | NGSRLILFGLSPSVREVMELSRLQKIFEIYDSEEQALAS* |
| Ga0126381_1026946361 | 3300010376 | Tropical Forest Soil | LVEGLKVSRGLGARLILYGLNASVREVLQLSKLLKIFEVYENEEQAVSP* |
| Ga0137389_102881283 | 3300012096 | Vadose Zone Soil | ILIGLSTPAREVLQLSRLTKVFEIYDTEEQALAT* |
| Ga0137388_102205151 | 3300012189 | Vadose Zone Soil | RDVGSRLILFGLSPIAQEVLQLSRLLKIFEIYDTEAKALEA* |
| Ga0137399_100049369 | 3300012203 | Vadose Zone Soil | RFILFGLNRTVREVLQLSKLVRIFEIYEDEAQSVAP* |
| Ga0137378_102683361 | 3300012210 | Vadose Zone Soil | ILIGLSTSAREVLQLSRLIKVFEIHDNEEQALAT* |
| Ga0137384_108273372 | 3300012357 | Vadose Zone Soil | GSRFMLFGLSTSAREILQLSRLIKVFEIYENEEQALAV* |
| Ga0137359_109682121 | 3300012923 | Vadose Zone Soil | GSRFIMFGLSGAAREVLQLSRLLKVFEVYDNEESALAS* |
| Ga0137359_114414272 | 3300012923 | Vadose Zone Soil | VGSRLVLFGLSPIAHEVLQLSRLLTIFEIYDTEEKALEA* |
| Ga0137413_100070371 | 3300012924 | Vadose Zone Soil | RLILFGLSKTVREVMELSRLQKIFEIHDSEAQALAS* |
| Ga0137413_114926981 | 3300012924 | Vadose Zone Soil | FLLVGLSPAAREVLQLSRLLKIFEVFDTEEAALAS* |
| Ga0137419_105258732 | 3300012925 | Vadose Zone Soil | SRDVGSSLVLFGLSASTREVLQLSRLLKVFEVRDNEEQALAS* |
| Ga0137419_110390132 | 3300012925 | Vadose Zone Soil | ASRDQGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALAS* |
| Ga0181522_103072952 | 3300014657 | Bog | RLLLVGLSPAAREVLQLSRLLKIFEVFDTEEAALAG* |
| Ga0137414_10576392 | 3300015051 | Vadose Zone Soil | SRFILIGLSTSAREVLQLSRLIKVFEIYDTEEQALAT* |
| Ga0137405_10494712 | 3300015053 | Vadose Zone Soil | RFILIGLSTSAREVLQLSRLIKIFEIYDTEEQALAT* |
| Ga0182041_117279241 | 3300016294 | Soil | EGLRASRDIGSRLLLFGLSPIVREVLKLSRLLKIFEIYENEQQALSA |
| Ga0182033_104048722 | 3300016319 | Soil | RLLLFGLSPIVREVLKLSRLLKIFEIYENEQQALSA |
| Ga0182035_112187992 | 3300016341 | Soil | EGLRASRDIGSRLLLFGLSPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0182034_118232682 | 3300016371 | Soil | GSRLILFGLNSAVREVLQLSKLLKIFEIAETEEQAVAP |
| Ga0182039_100963401 | 3300016422 | Soil | DIGSRLLLFGLTPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0182039_106215011 | 3300016422 | Soil | RLILFGLNTTVREVMQLSRLQKIFEIYEDEEQALSS |
| Ga0182039_112718472 | 3300016422 | Soil | SRLILYSLSNTVREVMQLSRLQKIFEIYENEEQALSS |
| Ga0182039_112786662 | 3300016422 | Soil | LRASRDIGSRLLLFGLSPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0182038_118038761 | 3300016445 | Soil | VEGLRASRDIGSRLLLFGLTPVVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0187818_101688172 | 3300017823 | Freshwater Sediment | ASRDQGSRMILYGLSPTVREVMELSRLQRIFEIYDNEEQALSS |
| Ga0187803_104437321 | 3300017934 | Freshwater Sediment | DYGSRMILYGLSKSVREVMELSRLQKIFEIYENEEQALSS |
| Ga0187781_112306971 | 3300017972 | Tropical Peatland | RMILYGLSQAVREVMELSRLQRIFEIYDNEEQALST |
| Ga0187822_101744472 | 3300017994 | Freshwater Sediment | SLFGLSRVAREVLELTRLLKVFEVYESESQAIESTPPANP |
| Ga0187851_106913032 | 3300018046 | Peatland | SRLILFGLSPIAHEVLQLSKLLKIFEIYDTEDMALQA |
| Ga0187771_110315682 | 3300018088 | Tropical Peatland | LILYGLNKTVREVMQLSRLQKIFEIYEDEEQALAS |
| Ga0187770_100092448 | 3300018090 | Tropical Peatland | GARLILYGLSPAVREVMELSRLQKIFEIYLSEEQALSS |
| Ga0187770_107024991 | 3300018090 | Tropical Peatland | LGSRLILYGLNRTVREVMQLSRLQKIFEIYEDEEQALAS |
| Ga0193732_10475632 | 3300020012 | Soil | VEGLKGARDQGLRFILYGLSPSAREVLQLSRLIKIFEVFDNEQQALA |
| Ga0210403_113529822 | 3300020580 | Soil | QGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALAS |
| Ga0210399_109325452 | 3300020581 | Soil | FILIGLSPSAREVLQLSRLLKVFEVYDDEATALSSQ |
| Ga0210401_115451631 | 3300020583 | Soil | RFILVGLNGPAREVLQLSRLLKVFEIYDTELEALAARV |
| Ga0215015_110847931 | 3300021046 | Soil | FILFGLSPSAREVLQLSRLLRIFEVYDNEDQALAS |
| Ga0210400_104131741 | 3300021170 | Soil | DQGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALDS |
| Ga0210408_101535723 | 3300021178 | Soil | KASRDQGSRLILYGLSKTVREVMELSRLQKIFEIHESEAQALAS |
| Ga0210408_102883371 | 3300021178 | Soil | DIGSRFILVGLNGPAREVLQLSRLLKVFEIYDTEGEALVARV |
| Ga0210388_103310593 | 3300021181 | Soil | MRFALVGLSKGAREVLQLSRLIKIFEIHDNEEQALA |
| Ga0210388_105357543 | 3300021181 | Soil | RLILYSLSNTVREVMQLSRLQKIFEIYENEEQALSS |
| Ga0210388_117997291 | 3300021181 | Soil | GSRLILYGLSKTVREVMELSRLQRIFEIYDNEEQAVSSEGHK |
| Ga0210393_100773224 | 3300021401 | Soil | AARDVGWRSFLFGLSTSAREVLQLSRLLKIFEVYENEEQALAA |
| Ga0210385_108105712 | 3300021402 | Soil | RDQGLRFILYGLSPSAREVLQLSRLIKIFEVFDNEQQALA |
| Ga0210397_105122222 | 3300021403 | Soil | KASRDQGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALDS |
| Ga0210394_102428663 | 3300021420 | Soil | LFGLSTSAREVLQLSRLLKIFEVYDNEEQALAGQV |
| Ga0210384_117880571 | 3300021432 | Soil | GSRFVLFGLSGAPREVLQLQRLLKTFEIYDTEAEALAS |
| Ga0247667_10011321 | 3300024290 | Soil | FILFGLSKSAREVLQLSRLLKLFEIYENEEQALSAESV |
| Ga0257176_10474951 | 3300026361 | Soil | SRDMGSRFVLFGLSASAREVLQLSRLLKIFEVRDDEEQALTS |
| Ga0209059_12290341 | 3300026527 | Soil | RLILFGLNKTVREVLQLSKLVRIFEIYENEAQSVAP |
| Ga0207723_1027851 | 3300026824 | Tropical Forest Soil | GSRLILFGLSPAVREVLQLSRLQKIFEIYDNEEQALAS |
| Ga0207787_10074773 | 3300026908 | Tropical Forest Soil | VEGLRASRDIGSRLLLFGLSPVVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0207741_10107602 | 3300026941 | Tropical Forest Soil | SLVEGLRASRDIGSRLLLFGLSPVVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0208983_10822441 | 3300027381 | Forest Soil | LVLFGLNKTVREVLQLSKLVRIFEIHENEEQSVAP |
| Ga0209219_10357653 | 3300027565 | Forest Soil | DQGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALAS |
| Ga0208982_10982291 | 3300027574 | Forest Soil | TRFLLVGLSPAAREVLQLSRLLKIFETFDTEEAALAS |
| Ga0209331_10061875 | 3300027603 | Forest Soil | SRFILYGLSQSAREVMQLSKLNKIFEIYELEEQALAS |
| Ga0209422_10183723 | 3300027629 | Forest Soil | AARDQKLRFILYGLSPSAREVLQLSRLIKIFEVFDNEQQALA |
| Ga0209446_11266611 | 3300027698 | Bog Forest Soil | LILYGLSKTVREVMELSRLQKIFEIYDNEEQALAAEVRK |
| Ga0209328_100703421 | 3300027727 | Forest Soil | RFILYGLSPSAREVLQLSRLIKIFEVFDNEQQALA |
| Ga0209073_104443601 | 3300027765 | Agricultural Soil | SRDSGSRLILFGLNSAIREVLQLSKLLRIFEITDTEEQAVAP |
| Ga0209579_104928322 | 3300027869 | Surface Soil | RFILVGLSTSTREVLQLSRLIKVFEIYDNEEQAMAS |
| Ga0247682_10242671 | 3300028146 | Soil | LFGLSKSAREVLQLSRLLKLFEIYENEEQALSGESV |
| Ga0257175_10424412 | 3300028673 | Soil | RLVLFGLSASAREVLQLSRLLKVFEVRDNEEQALTS |
| Ga0308309_102093811 | 3300028906 | Soil | LYGLSKTVREVMELSRLQRIFEIYDNEEQAVSSEGHK |
| (restricted) Ga0255310_101683002 | 3300031197 | Sandy Soil | RLILYALNPPVREVMELSRLQKIFEIYDNEEQALSS |
| Ga0265331_103314281 | 3300031250 | Rhizosphere | LILFGLSPIAHEVLQLSKLLKIFEIYDTEDMALQA |
| Ga0318516_105105091 | 3300031543 | Soil | SRDLGSRLILFGLSSGVREVLQLSKLIRVFEIADTEEQAVAP |
| Ga0318561_104297062 | 3300031679 | Soil | GSRLILFGLSSGVREVLQLSKLIRVFEIADTEEQAVAP |
| Ga0307469_104337763 | 3300031720 | Hardwood Forest Soil | LILYGLSKTVREVMELSRLQKIFEIHDSEAQALAS |
| Ga0307477_102231181 | 3300031753 | Hardwood Forest Soil | RFILFGLSASAREVLQLSRLLKIFEVYDDEVQALSS |
| Ga0307475_105666211 | 3300031754 | Hardwood Forest Soil | FILIGLSTSAREVLQLSRLIKVFEIYDNEEQALAT |
| Ga0307478_101437881 | 3300031823 | Hardwood Forest Soil | FILVGLSTSAREVLRLSRLLRVFEVYENEQEALAS |
| Ga0306919_106721021 | 3300031879 | Soil | EQGSRLILFGLSPAVREVLQLSRLQKIFEIYDNEEQALAS |
| Ga0310912_102718621 | 3300031941 | Soil | DIGSRLLLIGLSPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0310912_109327681 | 3300031941 | Soil | LILFGLSPAVKEVMQLSRLQKIFEIYDNEEQALAS |
| Ga0310910_102253121 | 3300031946 | Soil | DIGSRLLLFGLSPIVREVLQLSRLHKIFEIYENEQQALSA |
| Ga0310909_108843801 | 3300031947 | Soil | RLLLIGLSPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0306926_113780512 | 3300031954 | Soil | GSRLILFALNPAVREVMELSRLQKIFEIYDSEEQALAA |
| Ga0306922_103744161 | 3300032001 | Soil | LILFGLSPAVREVLQLSRLQKIFEIYDNEEQALAS |
| Ga0306922_114129073 | 3300032001 | Soil | DLGARLILFGLNATIREVLQLSKLLKIFEIYDTEEQALAP |
| Ga0310911_100826581 | 3300032035 | Soil | SRLLLFGLSPIVREVLQLSRLHKIFEIYENEQQALSA |
| Ga0318556_103328021 | 3300032043 | Soil | LILFGLSSGVREVLQLSKLIRVFEIADTEEQAVAP |
| Ga0307470_117436222 | 3300032174 | Hardwood Forest Soil | ASRDQGSRLILYGLSKTVREVMELSRLQKIFEIHDSEAQALAS |
| Ga0306920_1012186501 | 3300032261 | Soil | SRDIGSRLLLFGLSPIVREVLQLSRLLKIFEIYENEQQALSA |
| Ga0335085_119933662 | 3300032770 | Soil | NGARMILYGLSPSVREVMELSRLQKIFEIYDNEEQALSS |
| Ga0316212_10239622 | 3300033547 | Roots | STSAREVLQLSRLLKIFEVYDNEEQALAGQQTISGQ |
| Ga0364943_0306794_492_599 | 3300034354 | Sediment | FILFGLSGSAREVLQLSRLLKIFEVYDNEEQALTS |
| ⦗Top⦘ |