NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RepKanNP_BrdU_F12BDRAFT_1009115

Scaffold RepKanNP_BrdU_F12BDRAFT_1009115


Overview

Basic Information
Taxon OID3300000564 Open in IMG/M
Scaffold IDRepKanNP_BrdU_F12BDRAFT_1009115 Open in IMG/M
Source Dataset NameAmended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)652
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location
Location NameKanza Prairie, Kansas, USA
CoordinatesLat. (o)39.100992Long. (o)-96.608258Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068242Metagenome125N

Sequences

Protein IDFamilyRBSSequence
RepKanNP_BrdU_F12BDRAFT_10091152F068242AGGAGMKLRDVTRVDGGAVTHVWPPQLLVQIGPMIVQPGEGVLKSVKRFRSRLSLTVEHEGQEAWGGIEVEQDQRPSVDAVERALKASVGKAIEEIGDLDVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.