NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold F21B_12015833

Scaffold F21B_12015833


Overview

Basic Information
Taxon OID3300000561 Open in IMG/M
Scaffold IDF21B_12015833 Open in IMG/M
Source Dataset NameAmended soil microbial communities from Kansas Great Prairies, USA - acetate DNA F2.1B clc assemly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location
Location NameKanza Prairie, Kansas, USA
CoordinatesLat. (o)39.100992Long. (o)-96.608258Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057593Metagenome136Y

Sequences

Protein IDFamilyRBSSequence
F21B_120158331F057593GAGGMTTAKKYRAHAKKCFVRAQETDSEELRQASLEMASYWMDAAMRTECLGDSHVEPEQQAA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.