Scaffold SL_8KL_010_SEDDRAFT_10054734

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SL_8KL_010_SEDDRAFT_10054734

Scaffold SL_8KL_010_SEDDRAFT_10054734

Overview

Basic Information
Taxon OID	3300000557 Open in IMG/M
Scaffold ID	SL_8KL_010_SEDDRAFT_10054734 Open in IMG/M
Source Dataset Name	Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1765
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location Name	Russia: Kulunda Steppe, Lake Tanatar
Coordinates	Lat. (^o)	51.39	Long. (^o)	79.48	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_8KL_010_SEDDRAFT_100547343	F066493	GGAGG	MSDAREFDSGVVDVADELVQRHGTSGAIDRLQRRRQTSNDELQARCTEAIAWIRREVMDDT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.