| Basic Information | |
|---|---|
| Taxon OID | 3300000549 Open in IMG/M |
| Scaffold ID | LJQas_1013323 Open in IMG/M |
| Source Dataset Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 968 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sierra Nevada National Park, Granada, Spain | |||||||
| Coordinates | Lat. (o) | 36.95744 | Long. (o) | -3.46336 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049264 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LJQas_10133232 | F049264 | AGGAGG | MRFVVAILACLVLSSVGVGTAQAAPPSAVVLPKKATLLPDGSVQIRMKVRCNDQQQAFEWSVDVRQGTIFGNDSAGPVAGLITCDGRFHRVDALVAGANGPFTAGPATVQALVQLFDADEGSDVELEDRAVVRL |
| ⦗Top⦘ |