Scaffold PROU1_102213

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PROU1_102213

Scaffold PROU1_102213

Overview

Basic Information
Taxon OID	3300000530 Open in IMG/M
Scaffold ID	PROU1_102213 Open in IMG/M
Source Dataset Name	Acid mine drainage (AMD) microbial communities from Fan Kou Mine, Shaoguan city, Guangdong Province, China - PRO_U
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Macrogen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6974
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Acid Mine Drainage → Acid Mine Drainage (Amd) Microbial Communities From Fan Kou Mine, Shaoguan City, Guangdong Province, China

Source Dataset Sampling Location
Location Name	Fankou, Shaoguan City, China
Coordinates	Lat. (^o)	24.814784	Long. (^o)	113.602638	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036523	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
PROU1_1022134	F036523	AGGA	MAYNYGSPITGTLTATTAVVTFPNEPMPASIVLNSSAAGRAIQFSFDNGITFYPAVTPTYTETGQIVYVLNFPVTTIQFTGAVNDTYAIIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.