Scaffold PROU1_101631

Overview

Basic Information

• Taxon OID: 3300000530
• Scaffold ID: PROU1_101631
• Source Dataset Name: Acid mine drainage (AMD) microbial communities from Fan Kou Mine, Shaoguan city, Guangdong Province, China - PRO_U
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30504
• Total Scaffold Genes: 48
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 34 (70.83%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Acid Mine Drainage → Acid Mine Drainage (Amd) Microbial Communities From Fan Kou Mine, Shaoguan City, Guangdong Province, China

Source Dataset Sampling Location

• Location Name: Fankou, Shaoguan City, China
• Coordinates
  • Lat. (^o): 24.814784
  • Long. (^o): 113.602638
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034504	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
PROU1_10163117	F034504	N/A	MKIDFYLKWTATAITILGAVFTSVNMYPMGPALLNLGALGWLIVAIRWREWSLITINGTLLLIYTVGLISKLI*