| Basic Information | |
|---|---|
| Taxon OID | 3300000530 Open in IMG/M |
| Scaffold ID | PROU1_101407 Open in IMG/M |
| Source Dataset Name | Acid mine drainage (AMD) microbial communities from Fan Kou Mine, Shaoguan city, Guangdong Province, China - PRO_U |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1644 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Acid Mine Drainage → Acid Mine Drainage (Amd) Microbial Communities From Fan Kou Mine, Shaoguan City, Guangdong Province, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fankou, Shaoguan City, China | |||||||
| Coordinates | Lat. (o) | 24.814784 | Long. (o) | 113.602638 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036523 | Metagenome | 169 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PROU1_1014073 | F036523 | AGGA | MAYNYGSPITGTLTTTTAVVQFPNEPMPASIVLNSASGSRAIQFSFDNGTTFYPAVTPTYSETGQIVYVLNFPVTTIQFTGAVNDTYAIIS* |
| ⦗Top⦘ |