| Basic Information | |
|---|---|
| Taxon OID | 3300000495 Open in IMG/M |
| Scaffold ID | ML7_108444 Open in IMG/M |
| Source Dataset Name | Lentic microbial communities from White Lake grasslands, BC, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 758 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From White Lake Grasslands, Bc, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Lake grasslands, BC, Canada | |||||||
| Coordinates | Lat. (o) | 49.2833 | Long. (o) | -119.5833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082368 | Metagenome | 113 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ML7_1084442 | F082368 | AGGAG | MEIELWTLFDALMKWVIIPMAAMLWVHNQKIGAHEKEVLRIMTLLSERKDQRDEDRAELKEALRDLRAAILRLDQRLADFALAQSAQTPAPEPTRQTASRRAKG* |
| ⦗Top⦘ |