3300000495: Lentic microbial communities from White Lake grasslands, BC, Canada

Overview

Basic Information

• IMG/M Taxon OID: 3300000495
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0074126 | Gp0054485 | Ga0011521
• Sample Name: Lentic microbial communities from White Lake grasslands, BC, Canada
• Sequencing Status: Permanent Draft
• Sequencing Center: Pennsylvania State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22541773
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Lentic Microbial Communities From White Lake Grasslands, Bc, Canada
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From White Lake Grasslands, Bc, Canada

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: White Lake grasslands, BC, Canada
• Coordinates
  • Lat. (^o): 49.2833
  • Long. (^o): -119.5833
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082368	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ML7_108444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	758

Sequences

Scaffold ID	Protein ID	Family	Sequence
ML7_108444	ML7_1084442	F082368	MEIELWTLFDALMKWVIIPMAAMLWVHNQKIGAHEKEVLRIMTLLSERKDQRDEDRAELKEALRDLRAAILRLDQRLADFALAQSAQTPAPEPTRQTASRRAKG*