| Basic Information | |
|---|---|
| Taxon OID | 3300000493 Open in IMG/M |
| Scaffold ID | MLSed_101071 Open in IMG/M |
| Source Dataset Name | Lentic microbial communities from White Lake grasslands, BC, Canada |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4294 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis → Candidatus Nitrososphaera evergladensis SR1 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Microbial Communities From White Lake Grasslands, Bc, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Lake grasslands, BC, Canada | |||||||
| Coordinates | Lat. (o) | 49.2833 | Long. (o) | -119.5833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014681 | Metagenome / Metatranscriptome | 261 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MLSed_10107113 | F014681 | AGGAGG | MRSFLKDIRGVVDLGLVLMIGIAFAGLAVIAYIIYTLVDMLDATGSAAQTMGNITSGFDNAIALILVAITIFILSIAISALLMLRGR* |
| ⦗Top⦘ |