| Basic Information | |
|---|---|
| Taxon OID | 3300000482 Open in IMG/M |
| Scaffold ID | Lynggard_1024615 Open in IMG/M |
| Source Dataset Name | Anaerobic digester microbial communities from Northern Denmark, sample from Lynggard manure |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1048 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Soeholt, Denmark | |||||||
| Coordinates | Lat. (o) | 56.446744 | Long. (o) | 9.372697 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033394 | Metagenome / Metatranscriptome | 177 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Lynggard_10246152 | F033394 | N/A | MKSIYIYFVDEKADIYYKDNSKNLHCTINLYTTNKEIRAQFRKNLLERYWDKIEITDINDLKMIVKDSFVQIFTLQREKIDKND* |
| ⦗Top⦘ |