| Basic Information | |
|---|---|
| Taxon OID | 3300000478 Open in IMG/M |
| Scaffold ID | BPH_13047 Open in IMG/M |
| Source Dataset Name | Deep mine microbial communities from Beatrix mine, South Africa, that are thermophilic, sample 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Inqaba Biotechnologies |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1767 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Mine → Deep Mine → Deep Mine Microbial Communities From Beatrix Mine, South Africa, That Are Thermophilic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Beatrix mine, Free State, South Africa | |||||||
| Coordinates | Lat. (o) | -28.3 | Long. (o) | 26.75 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BPH_130473 | F015419 | N/A | MEYKVQITDEAGNIRQYNVSRSSSSEDKSLNDFILEALQISEDKRKLPLKIQCPNGLEVYPSIKMKFENYGSPLLGDKLEAMHITWRDGL* |
| ⦗Top⦘ |