Scaffold BPH_10975

Overview

Basic Information

• Taxon OID: 3300000478
• Scaffold ID: BPH_10975
• Source Dataset Name: Deep mine microbial communities from Beatrix mine, South Africa, that are thermophilic, sample 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Inqaba Biotechnologies
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 759
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Mine → Deep Mine → Deep Mine Microbial Communities From Beatrix Mine, South Africa, That Are Thermophilic

Source Dataset Sampling Location

• Location Name: Beatrix mine, Free State, South Africa
• Coordinates
  • Lat. (^o): -28.3
  • Long. (^o): 26.75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042051	Metagenome / Metatranscriptome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
BPH_109751	F042051	AGGAG	MTTFGEVNWNDDVFGGNEGKKNTNGKDLFLRLKEGSNEMRLVTQPFQYLVHKYKKEGDSGFGQKVHCSAIHGSCPLCETGDKAKPRWLLGVISRESGTYKILDISFAVFSQIRKLAKNTQRWGDPTKYDIDIVVDKNGGATGYYSVQPISKEPLSAADQKIKDNVDLDDLKRRVTPPTADLVQKRIDKINGVGDANAAAPAKGKPATKAPAKAAAPAVSMTDDEEMDESFPAY