Scaffold M590M1_1000184

Overview

Basic Information

• Taxon OID: 3300000470
• Scaffold ID: M590M1_1000184
• Source Dataset Name: Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Photosynthetic Consortia grown using light of 590nm sample 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 122003
• Total Scaffold Genes: 132
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 103 (78.03%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Microbial Communities From Little Sippewissett, Woods Hole, Ma That Are Anoxygenic And Photosynthetic

Source Dataset Sampling Location

• Location Name: Little Sippewissett Salt Marsh, Woods Hole, MA
• Coordinates
  • Lat. (^o): 41.5758508
  • Long. (^o): -70.635807

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084812	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
M590M1_100018437	F084812	AGTAGG	MSNSIKLDNYGKGLLVNIISKAISNDRDLTEDDVEKLKEIKKQLQEG*