NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold F12B_10954579

Scaffold F12B_10954579


Overview

Basic Information
Taxon OID3300000443 Open in IMG/M
Scaffold IDF12B_10954579 Open in IMG/M
Source Dataset NameAmended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)649
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location
Location NameKanza Prairie, Kansas, USA
CoordinatesLat. (o)39.100992Long. (o)-96.608258Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092801Metagenome107N

Sequences

Protein IDFamilyRBSSequence
F12B_109545791F092801N/AMDPASQRIRDKLWYGLLPNVAPVKTWGGYGTGHKPCDGCDVTIAAREVEHEVELADGRTLSFHIACAKLWQVLRTALPENQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.