Scaffold P_1C_Liq_2_UnCtyDRAFT_1025566

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P_1C_Liq_2_UnCtyDRAFT_1025566

Scaffold P_1C_Liq_2_UnCtyDRAFT_1025566

Overview

Basic Information
Taxon OID	3300000427 Open in IMG/M
Scaffold ID	P_1C_Liq_2_UnCtyDRAFT_1025566 Open in IMG/M
Source Dataset Name	Marine microbial community from Union City, CA, USA - Pond 1C Liquid 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	521
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Salt Pond → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Eden Landing Ponds, San Francisco, CA, USA
Coordinates	Lat. (^o)	37.5693	Long. (^o)	-122.102517	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038111	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
P_1C_Liq_2_UnCtyDRAFT_10255662	F038111	N/A	MIPSKVAVANKPEYTIWLENYKNIATFIHADVYKYNKTIRQEFGKDLDLLADLHNSPLYVLTHKDNKKLKKFMSIYGLVLDHKPLCDDGIEREVYRLDRRA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.