Basic Information | |
---|---|
Taxon OID | 3300000427 Open in IMG/M |
Scaffold ID | P_1C_Liq_2_UnCtyDRAFT_1001252 Open in IMG/M |
Source Dataset Name | Marine microbial community from Union City, CA, USA - Pond 1C Liquid 2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3177 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Salt Pond → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.5693 | Long. (o) | -122.102517 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097996 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
P_1C_Liq_2_UnCtyDRAFT_10012522 | F097996 | GGAG | MAINREGMHPRYLGFQVDWPVFIKIPFTADGKQWKKSEHFNWAERNIDTKDAASLYAQGFIYHNTELNKANKVGDRLSEMNAEDLRSVVTQLNAIVKDRTSSNQEFNNKKCKQSKIEDKQRGLIRRFLNHNPWIAEQFYEIRDTILGE* |
⦗Top⦘ |