Scaffold P_1C_Liq_2_UnCtyDRAFT_1001252

Overview

Basic Information

• Taxon OID: 3300000427
• Scaffold ID: P_1C_Liq_2_UnCtyDRAFT_1001252
• Source Dataset Name: Marine microbial community from Union City, CA, USA - Pond 1C Liquid 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3177
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Salt Pond → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.5693
  • Long. (^o): -122.102517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097996	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
P_1C_Liq_2_UnCtyDRAFT_10012522	F097996	GGAG	MAINREGMHPRYLGFQVDWPVFIKIPFTADGKQWKKSEHFNWAERNIDTKDAASLYAQGFIYHNTELNKANKVGDRLSEMNAEDLRSVVTQLNAIVKDRTSSNQEFNNKKCKQSKIEDKQRGLIRRFLNHNPWIAEQFYEIRDTILGE*