Scaffold BB_Man_B_Liq_inBBDRAFT_1022880

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BB_Man_B_Liq_inBBDRAFT_1022880

Scaffold BB_Man_B_Liq_inBBDRAFT_1022880

Overview

Basic Information
Taxon OID	3300000401 Open in IMG/M
Scaffold ID	BB_Man_B_Liq_inBBDRAFT_1022880 Open in IMG/M
Source Dataset Name	Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	752
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Bioluminescent Bay, La Paraguera, Puerto Rico
Coordinates	Lat. (^o)	17.966667	Long. (^o)	-67.0	Alt. (m)		Depth (m)	.39
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085647	Metagenome / Metatranscriptome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
BB_Man_B_Liq_inBBDRAFT_10228802	F085647	N/A	MLWQDRNGTWHSTVSPIDIKIRNAMIEANANKVWEEKERSGDWLFDEMFGGDLTTRAL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.