Basic Information | |
---|---|
Taxon OID | 3300000401 Open in IMG/M |
Scaffold ID | BB_Man_B_Liq_inBBDRAFT_1022880 Open in IMG/M |
Source Dataset Name | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 752 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
Coordinates | Lat. (o) | 17.966667 | Long. (o) | -67.0 | Alt. (m) | Depth (m) | .39 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085647 | Metagenome / Metatranscriptome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BB_Man_B_Liq_inBBDRAFT_10228802 | F085647 | N/A | MLWQDRNGTWHSTVSPIDIKIRNAMIEANANKVWEEKERSGDWLFDEMFGGD*LTTRAL* |
⦗Top⦘ |