Scaffold P_1C_Sed_2_UnCtyDRAFT_1005819

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P_1C_Sed_2_UnCtyDRAFT_1005819

Scaffold P_1C_Sed_2_UnCtyDRAFT_1005819

Overview

Basic Information
Taxon OID	3300000374 Open in IMG/M
Scaffold ID	P_1C_Sed_2_UnCtyDRAFT_1005819 Open in IMG/M
Source Dataset Name	Marine sediment microbial community from Union City, CA, USA - Pond 1C Sediment 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	2789
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Salt Pond → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Eden Landing Ponds, San Francisco, CA, USA
Coordinates	Lat. (^o)	37.569083	Long. (^o)	-122.103267	Alt. (m)		Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078611	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
P_1C_Sed_2_UnCtyDRAFT_10058196	F078611	N/A	MNNRTTINIDKELREILKSKRKYKRETYDEVLKRILKDKQKMRGMK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.