Scaffold P_2C_Liq_3_UnCtyDRAFT_100528

Overview

Basic Information

• Taxon OID: 3300000369
• Scaffold ID: P_2C_Liq_3_UnCtyDRAFT_100528
• Source Dataset Name: Marine microbial community from Union City, CA, USA - Pond 2C Liquid 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 11355
• Total Scaffold Genes: 29
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 27 (93.10%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.568817
  • Long. (^o): -122.10315
  • Depth (m): .11

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074584	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
P_2C_Liq_3_UnCtyDRAFT_10052811	F074584	AGGA	MKFSRWNEHGTKVEVEVHDESTLDEVLEEFQNFLRACGYVIEYNKVLDIVDMNE*