Scaffold SS_2KS_010_SOILDRAFT_10111291

Overview

Basic Information

• Taxon OID: 3300000367
• Scaffold ID: SS_2KS_010_SOILDRAFT_10111291
• Source Dataset Name: Alkaline soda soil microbial communities from Kulunda Steppe, Russia - 2KS_010_SOIL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 768
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe
• Coordinates
  • Lat. (^o): 52.1
  • Long. (^o): 79.14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015517	Metagenome / Metatranscriptome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
SS_2KS_010_SOILDRAFT_101112912	F015517	AGG	MYWRSIREADLPECLALQPACMGDSIVGREAALRAWQRLLDSPAFQASVIESEHLVAGHRIVACGLGVFVDRAFVDRELASPRPDLNSRIIASIVSGESVVLSREAIAVGNAGDGLDFVNLYGTWRDGVMDDDALAQVHSLLGTSFVENISGYRFNRVLKEAIGRPRIELARATGTYRLVAEFPERDSALAVVTPESARAAPYSYAA