| Basic Information | |
|---|---|
| Taxon OID | 3300000366 Open in IMG/M |
| Scaffold ID | SS_3KL_010_SOILDRAFT_10114207 Open in IMG/M |
| Source Dataset Name | Alkaline soda soil microbial communities from Kulunda Steppe, Russia - 3KL_010_SOIL |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 628 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Kulunda Steppe | |||||||
| Coordinates | Lat. (o) | 52.98 | Long. (o) | 82.1 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003605 | Metagenome / Metatranscriptome | 477 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SS_3KL_010_SOILDRAFT_101142072 | F003605 | AGGAGG | MAVGDDAQSAGIPLVPEVGEEGRTRWGALEINRTRDFIAQVKALLPIGKSGYRAASGITIGTEPPSGGSDGDLYFRYVEQEPTMEPM* |
| ⦗Top⦘ |